General Information

  • ID:  hor001365
  • Uniprot ID:  A0A8J5N0B2
  • Protein name:  FMRFamide-related peptide
  • Gene name:  NA
  • Organism:  Homarus americanus (American lobster)
  • Family:  FMRFamide related peptide family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homarus (genus), Nephropidae (family), Nephropoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  GGGEYDDYGHLRF
  • Length:  13(87-99)
  • Propeptide:  MRWTSWTAAVLVVMAAFMLSGGVSAPARPSSLARVLAPVVRQRSHLPPALVEELVQDFEDPELLDFHDAAGKREFDEYGHMRFGKRGGGEYDDYGHLRFGRSLTHSDQHHHHDTTVN
  • Signal peptide:  MRWTSWTAAVLVVMAAFMLSGG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001365_AF2.pdbhor001365_ESM.pdb

Physical Information

Mass: 169976 Formula: C66H88N18O22
Absent amino acids: ACIKMNPQSTVW Common amino acids: G
pI: 4.37 Basic residues: 2
Polar residues: 6 Hydrophobic residues: 2
Hydrophobicity: -121.54 Boman Index: -3245
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 30
Instability Index: 4891.54 Extinction Coefficient cystines: 2980
Absorbance 280nm: 248.33

Literature

  • PubMed ID:  18304551
  • Title:  Mass Spectral Characterization of Peptide Transmitters/Hormones in the Nervous System and Neuroendocrine Organs of the American Lobster Homarus Americanus